(data stored in ACNUC1104 zone)

EMBL: CP000717.PE399

CP000717.PE399       Location/Qualifiers
FT   CDS             478110..478514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10399"
FT                   /old_locus_tag="TBFG_00391"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0395"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10399"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04742"
FT                   /protein_id="ABR04742.1"
FT                   /translation="MDWMPLGDYETFRHWSGKPRAWGPQESGWRAWFGGKIVDGLCEVL
FT                   DEHLAVRRRGVPAAIGCVPWLSSEAVAETLLALSAFCVVIDKGTSFPSRLRNPDKGFPN
FT                   VALLRLRDMAPSEHGSRCSSARGRLCLSMS"
     MDWMPLGDYE TFRHWSGKPR AWGPQESGWR AWFGGKIVDG LCEVLDEHLA VRRRGVPAAI        60
     GCVPWLSSEA VAETLLALSA FCVVIDKGTS FPSRLRNPDK GFPNVALLRL RDMAPSEHGS       120
     RCSSARGRLC LSMS                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page