(data stored in ACNUC1104 zone)

EMBL: CP000717.PE403

CP000717.PE403       Location/Qualifiers
FT   CDS             complement(479849..480490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10403"
FT                   /old_locus_tag="TBFG_00395"
FT                   /product="hypothetical secreted protein"
FT                   /note="Mapped to H37Rv Rv0398c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10403"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04746"
FT                   /protein_id="ABR04746.1"
FT                   /translation="MGVIARVVGVAACGLSLAVLAAAPTAGAEPTGALPPMTSSGSGPV
FT                   IGDGDAALRQRISQQLFSFGDPTVQEVDGSDAAQFITAAAAVADRDVASVFLPLQRVLG
FT                   CQQNTAGSGAGFGARAYRRTDGQWGGAMLVVAKSTVSDVDALKACVKSGWRKATAGTPT
FT                   SMCNNGWTYPPFADTRRGEEGYFVLLAGTASDFCSAPNANYRTTASSWPG"
     MGVIARVVGV AACGLSLAVL AAAPTAGAEP TGALPPMTSS GSGPVIGDGD AALRQRISQQ        60
     LFSFGDPTVQ EVDGSDAAQF ITAAAAVADR DVASVFLPLQ RVLGCQQNTA GSGAGFGARA       120
     YRRTDGQWGG AMLVVAKSTV SDVDALKACV KSGWRKATAG TPTSMCNNGW TYPPFADTRR       180
     GEEGYFVLLA GTASDFCSAP NANYRTTASS WPG                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page