(data stored in ACNUC1104 zone)

EMBL: CP000717.PE414

CP000717.PE414       Location/Qualifiers
FT   CDS             497021..498178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10414"
FT                   /old_locus_tag="TBFG_00406"
FT                   /product="acetate kinase ackA (acetokinase)"
FT                   /note="Mapped to H37Rv Rv0409"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10414"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04757"
FT                   /protein_id="ABR04757.1"
FT                   /translation="MSSTVLVINSGSSSLKFQLVEPVAGMSRAAGIVERIGERSSPVAD
FT                   HAQALHRAFKMLAEDGIDLQTCGLVAVGHRVVHGGTEFHQPTLLDDTVIGKLEELSALA
FT                   PLHNPPAVLGIKVARRLLANVAHVAVFDTAFFHDLPPAAATYAIDRDVADRWHIRRYGF
FT                   HGTSHQYVSERAAAFLGRPLDGLNQIVLHLGNGASASAIARGRPVETSMGLTPLEGLVM
FT                   GTRSGDLDPGVISYLWRTARMGVEDIESMLNHRSGMLGLAGERDFRRLRLVIETGDRSA
FT                   QLAYEVFIHRLRKYLGAYLAVLGHTDVVSFTAGIGENDAAVRRDALAGLQGLGIALDQD
FT                   RNLGPGHGARRISSDDSPIAVLVVPTNEELAIARDCLRVLGGRRA"
     MSSTVLVINS GSSSLKFQLV EPVAGMSRAA GIVERIGERS SPVADHAQAL HRAFKMLAED        60
     GIDLQTCGLV AVGHRVVHGG TEFHQPTLLD DTVIGKLEEL SALAPLHNPP AVLGIKVARR       120
     LLANVAHVAV FDTAFFHDLP PAAATYAIDR DVADRWHIRR YGFHGTSHQY VSERAAAFLG       180
     RPLDGLNQIV LHLGNGASAS AIARGRPVET SMGLTPLEGL VMGTRSGDLD PGVISYLWRT       240
     ARMGVEDIES MLNHRSGMLG LAGERDFRRL RLVIETGDRS AQLAYEVFIH RLRKYLGAYL       300
     AVLGHTDVVS FTAGIGENDA AVRRDALAGL QGLGIALDQD RNLGPGHGAR RISSDDSPIA       360
     VLVVPTNEEL AIARDCLRVL GGRRA                                             385
//

If you have problems or comments...

PBIL Back to PBIL home page