(data stored in ACNUC1104 zone)

EMBL: CP000717.PE417

CP000717.PE417       Location/Qualifiers
FT   CDS             complement(501470..502789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10417"
FT                   /old_locus_tag="TBFG_00409"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0412c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10417"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04760"
FT                   /protein_id="ABR04760.1"
FT                   /translation="MTVELAHPSTEPLGSRSPAEPAHPRRWFISTTPGRIMTIGIVLAA
FT                   LGVASAFATSTTIEHRQQVLTAVLDHTEPLSFAAGRLYTTLSVADAAAATAFIAQAEPG
FT                   GVRLRYEQAITDASVAVTRASSGLTDESLVQLLGRINAELAVYTGLVEIARANNRAGNP
FT                   VGSSYLSEASGLMQSTILPDAQRLYQATSARVDRETTASTQIPAPVILVVATTVVFGAF
FT                   AHRWLARRTRRRINPGLVVGALGILVMVVWVGTALTISTTASRSAKDTAAESLKTITNL
FT                   AITAQQARADETLSLIRRGDEEVRKQAFYQRIDAMQRQLNDYMARRHAVDKPDLQGADQ
FT                   LLVRWRQANDRINSYISVGNYRAATQVALGKGEDDATPAFDKLDEALTKAMGQSRTQLR
FT                   HDILNAHRGLAGAQVGGVVLSLGAAIAVALGLWPRLKEYR"
     MTVELAHPST EPLGSRSPAE PAHPRRWFIS TTPGRIMTIG IVLAALGVAS AFATSTTIEH        60
     RQQVLTAVLD HTEPLSFAAG RLYTTLSVAD AAAATAFIAQ AEPGGVRLRY EQAITDASVA       120
     VTRASSGLTD ESLVQLLGRI NAELAVYTGL VEIARANNRA GNPVGSSYLS EASGLMQSTI       180
     LPDAQRLYQA TSARVDRETT ASTQIPAPVI LVVATTVVFG AFAHRWLARR TRRRINPGLV       240
     VGALGILVMV VWVGTALTIS TTASRSAKDT AAESLKTITN LAITAQQARA DETLSLIRRG       300
     DEEVRKQAFY QRIDAMQRQL NDYMARRHAV DKPDLQGADQ LLVRWRQAND RINSYISVGN       360
     YRAATQVALG KGEDDATPAF DKLDEALTKA MGQSRTQLRH DILNAHRGLA GAQVGGVVLS       420
     LGAAIAVALG LWPRLKEYR                                                    439
//

If you have problems or comments...

PBIL Back to PBIL home page