(data stored in ACNUC1104 zone)

EMBL: CP000717.PE418

CP000717.PE418       Location/Qualifiers
FT   CDS             502883..503536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10418"
FT                   /old_locus_tag="TBFG_00410"
FT                   /product="mutator protein mutT3"
FT                   /note="Mapped to H37Rv Rv0413"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10418"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04761"
FT                   /protein_id="ABR04761.1"
FT                   /translation="MPSCPPAYSEQVRGDGDGWVVSDSGVAYWGRYGAAGLLLRAPRPD
FT                   GTPAVLLQHRALWSHQGGTWGLPGGARDSHETPEQTAVRESSEEAGLSAERLEVRATVV
FT                   TAEVCGVDDTHWTYTTVVADAGELLDTVPNRESAELRWVAENEVADLPLHPGFAASWQR
FT                   LRTAPATVPLARCDERRQRLPRTIQIEAGVFLWCTPGDADQAPSPLGRRISSLL"
     MPSCPPAYSE QVRGDGDGWV VSDSGVAYWG RYGAAGLLLR APRPDGTPAV LLQHRALWSH        60
     QGGTWGLPGG ARDSHETPEQ TAVRESSEEA GLSAERLEVR ATVVTAEVCG VDDTHWTYTT       120
     VVADAGELLD TVPNRESAEL RWVAENEVAD LPLHPGFAAS WQRLRTAPAT VPLARCDERR       180
     QRLPRTIQIE AGVFLWCTPG DADQAPSPLG RRISSLL                                217
//

If you have problems or comments...

PBIL Back to PBIL home page