(data stored in ACNUC1104 zone)

EMBL: CP000717.PE42

CP000717.PE42        Location/Qualifiers
FT   CDS             complement(47467..48201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10042"
FT                   /old_locus_tag="TBFG_00042"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   gntR-family"
FT                   /note="Mapped to H37Rv Rv0043c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10042"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04385"
FT                   /protein_id="ABR04385.1"
FT                   /translation="MPKKYGVKEKDQVVAHILNLLLTGKLRSGDRVDRNEIAHGLGVSR
FT                   VPIQEALVQLEHDGIVSTRYHRGAFIERFDVATILEHHELDGLLNGIASARAAANPTPR
FT                   ILGQLDAVMRSLRNSKESRAFAECVWEYRRTVNDEYAGPRLHATIRASQNLIPRVFWMT
FT                   YQNSRDDVLPFYEEENAAIHRREPEAARAACIGRSELMAQTMLAELFRRRVLVPPEGAC
FT                   PGPFGAPIPGFARSYQPSSPVP"
     MPKKYGVKEK DQVVAHILNL LLTGKLRSGD RVDRNEIAHG LGVSRVPIQE ALVQLEHDGI        60
     VSTRYHRGAF IERFDVATIL EHHELDGLLN GIASARAAAN PTPRILGQLD AVMRSLRNSK       120
     ESRAFAECVW EYRRTVNDEY AGPRLHATIR ASQNLIPRVF WMTYQNSRDD VLPFYEEENA       180
     AIHRREPEAA RAACIGRSEL MAQTMLAELF RRRVLVPPEG ACPGPFGAPI PGFARSYQPS       240
     SPVP                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page