(data stored in ACNUC1104 zone)

EMBL: CP000717.PE421

CP000717.PE421       Location/Qualifiers
FT   CDS             505337..505543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10421"
FT                   /old_locus_tag="TBFG_00413"
FT                   /product="hypothetical protein thiS"
FT                   /note="Mapped to H37Rv Rv0416"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10421"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04764"
FT                   /protein_id="ABR04764.1"
FT                   /translation="MIVVVNEQQVEVDEQTTIAALLDSLGFGDRGIAVALNFSVLPRSD
FT                   WATKICELRKPVRLEVVTAVQGG"
     MIVVVNEQQV EVDEQTTIAA LLDSLGFGDR GIAVALNFSV LPRSDWATKI CELRKPVRLE        60
     VVTAVQGG                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page