(data stored in ACNUC1104 zone)

EMBL: CP000717.PE422

CP000717.PE422       Location/Qualifiers
FT   CDS             505536..506294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10422"
FT                   /old_locus_tag="TBFG_00414"
FT                   /product="thiamin biosynthesis protein thiG"
FT                   /note="Mapped to H37Rv Rv0417"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10422"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04765"
FT                   /protein_id="ABR04765.1"
FT                   /translation="MAESKLVIGDRSFASRLIMGTGGATNLAVLEQALIASGTELTTVA
FT                   IRRVDADGGTGLLDLLNRLGITPLPNTAGCRSAAEAVLTAQLAREALNTNWVKLEVIAD
FT                   ERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGLG
FT                   IANPHNIEMIVAGARVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAA
FT                   MAAAVTAGYLARCAGRIPKRFWAQASSPAR"
     MAESKLVIGD RSFASRLIMG TGGATNLAVL EQALIASGTE LTTVAIRRVD ADGGTGLLDL        60
     LNRLGITPLP NTAGCRSAAE AVLTAQLARE ALNTNWVKLE VIADERTLWP DAVELVRAAE       120
     QLVDDGFVVL PYTTDDPVLA RRLEDTGCAA VMPLGSPIGT GLGIANPHNI EMIVAGARVP       180
     VVLDAGIGTA SDAALAMELG CDAVLLASAV TRAADPPAMA AAMAAAVTAG YLARCAGRIP       240
     KRFWAQASSP AR                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page