(data stored in ACNUC1104 zone)

EMBL: CP000717.PE425

CP000717.PE425       Location/Qualifiers
FT   CDS             complement(509731..510141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10425"
FT                   /old_locus_tag="TBFG_00417"
FT                   /product="hypothetical transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0420c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10425"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04768"
FT                   /protein_id="ABR04768.1"
FT                   /translation="MRLHDASAAAPESRMHIARHGEAVNRRQMFIGITGLLLAVIGLMA
FT                   LWFPVYLDQYDAYGIKVTCGSGWRSNLTQALYADGNDNTQALVTRCDTALLVRRAWAIP
FT                   SVALGWLLVTGFLVMWVHNDQHQGQSYPGYRA"
     MRLHDASAAA PESRMHIARH GEAVNRRQMF IGITGLLLAV IGLMALWFPV YLDQYDAYGI        60
     KVTCGSGWRS NLTQALYADG NDNTQALVTR CDTALLVRRA WAIPSVALGW LLVTGFLVMW       120
     VHNDQHQGQS YPGYRA                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page