(data stored in ACNUC1104 zone)

EMBL: CP000717.PE436

CP000717.PE436       Location/Qualifiers
FT   CDS             522243..522737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10436"
FT                   /old_locus_tag="TBFG_00428"
FT                   /product="hypothetical tuberculin related peptide"
FT                   /note="Mapped to H37Rv Rv0431"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10436"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04779"
FT                   /protein_id="ABR04779.1"
FT                   /translation="MLVTVGSMNERVPDSSGLPLRAMVMVLLFLGVVFLLLVWQALGSS
FT                   PNSEDDSSAISTMTTTTAAPTSTSVKPAAPRAEVRVYNISGTEGAAARTADRLKAAGFT
FT                   VTDVGNLSLPDVAATTVYYTEVEGERATADAVGRTLGAAVELRLPELSDQPPGVIVVVT
FT                   G"
     MLVTVGSMNE RVPDSSGLPL RAMVMVLLFL GVVFLLLVWQ ALGSSPNSED DSSAISTMTT        60
     TTAAPTSTSV KPAAPRAEVR VYNISGTEGA AARTADRLKA AGFTVTDVGN LSLPDVAATT       120
     VYYTEVEGER ATADAVGRTL GAAVELRLPE LSDQPPGVIV VVTG                        164
//

If you have problems or comments...

PBIL Back to PBIL home page