(data stored in ACNUC1104 zone)

EMBL: CP000717.PE446

CP000717.PE446       Location/Qualifiers
FT   CDS             complement(533466..533852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10446"
FT                   /old_locus_tag="TBFG_00438"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0441c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10446"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04789"
FT                   /protein_id="ABR04789.1"
FT                   /translation="MPDYPFAYLITVDDGHRVHTVAVEPVLRELPDGPDGPRAVVDVGL
FT                   IGGRTRQNLAHRSEVTLLWPPSDPSGYSLIVDGRAQASDAGPDDDTARCGVVPIRALLH
FT                   RDAAPDSPTAAKGCLHDCVVFSVP"
     MPDYPFAYLI TVDDGHRVHT VAVEPVLREL PDGPDGPRAV VDVGLIGGRT RQNLAHRSEV        60
     TLLWPPSDPS GYSLIVDGRA QASDAGPDDD TARCGVVPIR ALLHRDAAPD SPTAAKGCLH       120
     DCVVFSVP                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page