(data stored in ACNUC1104 zone)

EMBL: CP000717.PE447

CP000717.PE447       Location/Qualifiers
FT   CDS             complement(533920..535383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10447"
FT                   /old_locus_tag="TBFG_00439"
FT                   /product="PPE family protein"
FT                   /note="Mapped to H37Rv Rv0442c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10447"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04790"
FT                   /protein_id="ABR04790.1"
FT                   /translation="MTSPHFAWLPPEINSALMFAGPGSGPLIAAATAWGELAEELLASI
FT                   ASLGSVTSELTSGAWLGPSAAAMMAVATQYLAWLSTAAAQAEQAAAQAMAIATAFEAAL
FT                   AATVQPAVVAANRGLMQLLAATNWFGQNAPALMDVEAAYEQMWALDVAAMAGYHFDASA
FT                   AVAQLAPWQQVLRNLGIDIGKNGQINLGFGNTGSGNIGNNNIGNNNIGSGNTGTGNIGS
FT                   GNTGSGNLGLGNLGDGNIGFGNTGSGNIGFGITGDHQMGFGGFNSGSGNIGFGNSGTGN
FT                   VGLFNSGSGNIGIGNSGSLNSGIGTSGTINAGLGSAGSLNTSFWNAGMQNAALGSAAGS
FT                   EAALVSSAGYATGGMSTAALSSGILASALGSTGGLQHGLANVLNSGLTNTPVAAPASAP
FT                   VGGLDSGNPNPGSGSAAAGSGANPGLRSPGTSYPSFVNSGSNDSGLRNTAVREPSTPGS
FT                   GIPKSNFYPSPDRESAYASPRIGQPVGSE"
     MTSPHFAWLP PEINSALMFA GPGSGPLIAA ATAWGELAEE LLASIASLGS VTSELTSGAW        60
     LGPSAAAMMA VATQYLAWLS TAAAQAEQAA AQAMAIATAF EAALAATVQP AVVAANRGLM       120
     QLLAATNWFG QNAPALMDVE AAYEQMWALD VAAMAGYHFD ASAAVAQLAP WQQVLRNLGI       180
     DIGKNGQINL GFGNTGSGNI GNNNIGNNNI GSGNTGTGNI GSGNTGSGNL GLGNLGDGNI       240
     GFGNTGSGNI GFGITGDHQM GFGGFNSGSG NIGFGNSGTG NVGLFNSGSG NIGIGNSGSL       300
     NSGIGTSGTI NAGLGSAGSL NTSFWNAGMQ NAALGSAAGS EAALVSSAGY ATGGMSTAAL       360
     SSGILASALG STGGLQHGLA NVLNSGLTNT PVAAPASAPV GGLDSGNPNP GSGSAAAGSG       420
     ANPGLRSPGT SYPSFVNSGS NDSGLRNTAV REPSTPGSGI PKSNFYPSPD RESAYASPRI       480
     GQPVGSE                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page