(data stored in ACNUC1104 zone)

EMBL: CP000717.PE457

CP000717.PE457       Location/Qualifiers
FT   CDS             complement(544657..545079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10457"
FT                   /old_locus_tag="TBFG_00448"
FT                   /product="membrane protein mmpS4"
FT                   /note="Mapped to H37Rv Rv0451c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10457"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04800"
FT                   /protein_id="ABR04800.1"
FT                   /translation="MLMRTWIPLVILVVVIVGGFTVHRIRGFFGSENRPSYSDTNLENS
FT                   KPFNPKHLTYEIFGPPGTVADISYFDVNSEPQRVDGAVLPWSLHITTNDAAVMGNIVAQ
FT                   GNSDSIGCRITVDGKVRAERVSNEVNAYTYCLVKSA"
     MLMRTWIPLV ILVVVIVGGF TVHRIRGFFG SENRPSYSDT NLENSKPFNP KHLTYEIFGP        60
     PGTVADISYF DVNSEPQRVD GAVLPWSLHI TTNDAAVMGN IVAQGNSDSI GCRITVDGKV       120
     RAERVSNEVN AYTYCLVKSA                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page