(data stored in ACNUC1104 zone)

EMBL: CP000717.PE466

CP000717.PE466       Location/Qualifiers
FT   CDS             554367..554858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10466"
FT                   /old_locus_tag="TBFG_00456"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0459"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10466"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04809"
FT                   /protein_id="ABR04809.1"
FT                   /translation="MNAPAGVLITAEAAALLAGLQDRHGPVMFHQSGGCCDGSAPMCYP
FT                   RADFLVGDRDILLGVLDVGEDGVPVWISGPQYQAWKHTQLIIDVVPGRGGGFSLEAPEG
FT                   VRFLSRGRVFSDAEKAMREAAPVITGAAYECGERPLVRGLVVDLDDPDATPGVCRASRR
FT                   "
     MNAPAGVLIT AEAAALLAGL QDRHGPVMFH QSGGCCDGSA PMCYPRADFL VGDRDILLGV        60
     LDVGEDGVPV WISGPQYQAW KHTQLIIDVV PGRGGGFSLE APEGVRFLSR GRVFSDAEKA       120
     MREAAPVITG AAYECGERPL VRGLVVDLDD PDATPGVCRA SRR                         163
//

If you have problems or comments...

PBIL Back to PBIL home page