(data stored in ACNUC1104 zone)

EMBL: CP000717.PE47

CP000717.PE47        Location/Qualifiers
FT   CDS             complement(51929..52798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10047"
FT                   /old_locus_tag="TBFG_00047"
FT                   /product="hypothetical membrane protein"
FT                   /note="Mapped to H37Rv Rv0048c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10047"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04390"
FT                   /protein_id="ABR04390.1"
FT                   /translation="MAKWLGAPLARGVSTATRAKDSDRQDACRILDDALRDGELSMEEH
FT                   RERVSAATKAVTLGDLQRLVADLQVESAPAQMPALKSRAKRTELGLLAAAFVASVLLGV
FT                   GIGWGVYGNTRSPLDFTSDPGAKPDGIAPVVLTPPRQLHSLGGLTGLLEQTRKRFGDTM
FT                   GYRLVIYPEYASLDRVDPADDRRVLAYTYRGGWGDATSSAKSIADVSVVDLSKFDAKTA
FT                   VGIMRGAPETLGLKQSDVKSMYLIVEPVKDPTTPAALSLSLYVSSDYGGGYLVFAGDGT
FT                   IKHVSYPS"
     MAKWLGAPLA RGVSTATRAK DSDRQDACRI LDDALRDGEL SMEEHRERVS AATKAVTLGD        60
     LQRLVADLQV ESAPAQMPAL KSRAKRTELG LLAAAFVASV LLGVGIGWGV YGNTRSPLDF       120
     TSDPGAKPDG IAPVVLTPPR QLHSLGGLTG LLEQTRKRFG DTMGYRLVIY PEYASLDRVD       180
     PADDRRVLAY TYRGGWGDAT SSAKSIADVS VVDLSKFDAK TAVGIMRGAP ETLGLKQSDV       240
     KSMYLIVEPV KDPTTPAALS LSLYVSSDYG GGYLVFAGDG TIKHVSYPS                   289
//

If you have problems or comments...

PBIL Back to PBIL home page