(data stored in ACNUC1104 zone)

EMBL: CP000717.PE471

CP000717.PE471       Location/Qualifiers
FT   CDS             complement(557482..558054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10471"
FT                   /old_locus_tag="TBFG_00461"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0464c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10471"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04814"
FT                   /protein_id="ABR04814.1"
FT                   /translation="MTGQNGQVARISPGKFRQLGPVNWLVAKLAARAVGAPQMHLFTTL
FT                   GYRQYLFWTFAIYTGRLLHGRLPGVDTELVILRVAHLRSCEYELQHHRRMARRRGLDAN
FT                   TQATIFAWPDVPDGDGPRKVLSARQQALLQATDELIKDRTITAGTWERLATHLDPRLLI
FT                   EFCLLATQYDAIAATITALAIPPDNPQ"
     MTGQNGQVAR ISPGKFRQLG PVNWLVAKLA ARAVGAPQMH LFTTLGYRQY LFWTFAIYTG        60
     RLLHGRLPGV DTELVILRVA HLRSCEYELQ HHRRMARRRG LDANTQATIF AWPDVPDGDG       120
     PRKVLSARQQ ALLQATDELI KDRTITAGTW ERLATHLDPR LLIEFCLLAT QYDAIAATIT       180
     ALAIPPDNPQ                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page