(data stored in ACNUC1104 zone)

EMBL: CP000717.PE472

CP000717.PE472       Location/Qualifiers
FT   CDS             complement(558051..559475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10472"
FT                   /old_locus_tag="TBFG_00462"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0465c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10472"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04815"
FT                   /protein_id="ABR04815.1"
FT                   /translation="MSKTYVGSRVRQLRNERGFSQAALAQMLEISPSYLNQIEHDVRPL
FT                   TVAVLLRITEVFGVDATFFASQDDTRLVAELREVTLDRDLDIAIDPHEVAEMVSAHPGL
FT                   ACAVVNLHRRYRITTAQLAAATEERFSDGSGRGSITMPHEEVRDYFYQRQNYLHALDTA
FT                   AEDLTAQMRMHHGDLARELTRRLTEVHGVRINKRIDLGDTVLHRYDPATNTLEISSHLS
FT                   PGQQVFKMAAELAYLEFGDLIDAMVTDGKFTSAESRTLARLGLANYFAAATVLPYRQFH
FT                   DVAENFRYDVERLSAFYSVSYETIAHRLSTLQRPSMRGVPFTFVRVDRAGNMSKRQSAT
FT                   GFHFSSSGGTCPLWNVYETFANPGKILVQIAQMPDGRNYLWVARTVELRAARYGQPGKT
FT                   FAIGLGCELRHAHRLVYSEGLDLSGDPNTAATPIGAGCRVCERDNCPQRAFPALGRALD
FT                   LDEHRSTVSPYLVKQL"
     MSKTYVGSRV RQLRNERGFS QAALAQMLEI SPSYLNQIEH DVRPLTVAVL LRITEVFGVD        60
     ATFFASQDDT RLVAELREVT LDRDLDIAID PHEVAEMVSA HPGLACAVVN LHRRYRITTA       120
     QLAAATEERF SDGSGRGSIT MPHEEVRDYF YQRQNYLHAL DTAAEDLTAQ MRMHHGDLAR       180
     ELTRRLTEVH GVRINKRIDL GDTVLHRYDP ATNTLEISSH LSPGQQVFKM AAELAYLEFG       240
     DLIDAMVTDG KFTSAESRTL ARLGLANYFA AATVLPYRQF HDVAENFRYD VERLSAFYSV       300
     SYETIAHRLS TLQRPSMRGV PFTFVRVDRA GNMSKRQSAT GFHFSSSGGT CPLWNVYETF       360
     ANPGKILVQI AQMPDGRNYL WVARTVELRA ARYGQPGKTF AIGLGCELRH AHRLVYSEGL       420
     DLSGDPNTAA TPIGAGCRVC ERDNCPQRAF PALGRALDLD EHRSTVSPYL VKQL             474
//

If you have problems or comments...

PBIL Back to PBIL home page