(data stored in ACNUC1104 zone)

EMBL: CP000717.PE487

CP000717.PE487       Location/Qualifiers
FT   CDS             complement(571090..572136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10487"
FT                   /old_locus_tag="TBFG_00477"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0479c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10487"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04830"
FT                   /protein_id="ABR04830.1"
FT                   /translation="MTNPQGPPNDPSPWARPGDQGPLARPPASSEASTGRLRPGEPAGH
FT                   IQEPVSPPTQPEQQPQTEHLAASHAHTRRSGRQAAHQAWDPTGLLAAQEEEPAAVKTKR
FT                   RARRDPLTVFLVLIIVFSLVLAGLIGGELYARHVANSKVAQAVACVVKDQATASFGVAP
FT                   LLLWQVATRHFTNISVETAGNQIRDAKGMQIKLTIQNVRLKNTPNSRGTIGALDATITW
FT                   SSEGIKESVQNAIPILGAFVTSSVVTHPADGTVELKGLLNNITAKPIVAGKGLELQIIN
FT                   FNTLGFSLPKETVQSTLNEFTSSLTKNYPLGIHADSVQVTSTGVVSRFSTRDAAIPTGI
FT                   QNPCFSHI"
     MTNPQGPPND PSPWARPGDQ GPLARPPASS EASTGRLRPG EPAGHIQEPV SPPTQPEQQP        60
     QTEHLAASHA HTRRSGRQAA HQAWDPTGLL AAQEEEPAAV KTKRRARRDP LTVFLVLIIV       120
     FSLVLAGLIG GELYARHVAN SKVAQAVACV VKDQATASFG VAPLLLWQVA TRHFTNISVE       180
     TAGNQIRDAK GMQIKLTIQN VRLKNTPNSR GTIGALDATI TWSSEGIKES VQNAIPILGA       240
     FVTSSVVTHP ADGTVELKGL LNNITAKPIV AGKGLELQII NFNTLGFSLP KETVQSTLNE       300
     FTSSLTKNYP LGIHADSVQV TSTGVVSRFS TRDAAIPTGI QNPCFSHI                    348
//

If you have problems or comments...

PBIL Back to PBIL home page