(data stored in ACNUC1104 zone)

EMBL: CP000717.PE49

CP000717.PE49        Location/Qualifiers
FT   CDS             53338..55803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10049"
FT                   /old_locus_tag="TBFG_00049"
FT                   /product="bifunctional penicillin-binding protein 1A/1B
FT                   ponA1: penicillin-insensitive transglycosylase +
FT                   penicillin-sensitive transpeptidase"
FT                   /note="Mapped to H37Rv Rv0050"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10049"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04392"
FT                   /protein_id="ABR04392.1"
FT                   /translation="MNSDGRHHQSSSGAPRGPANPGQRGQVPPDDRLTAILPPVTDDRS
FT                   APHADSIEAVKAALDGAPPMPPPRDPLEEVTAALAAPPGKPPRGDQLGGRRRPPGPPGP
FT                   PGSSGQPAGRLPQPRVDLPRVGQINWKWIRRSLYLTAAVVILLPMVTFTMAYLIVDVPK
FT                   PGDIRTNQVSTILASDGSEIAKIVPPEGNRVDVNLSQVPMHVRQAVIAAEDRNFYSNPG
FT                   FSFTGFARAVKNNLFGGDLQGGSTITQQYVKNALVGSAQHGWSGLMRKAKELVIATKMS
FT                   GEWSKDDVLQAYLNIIYFGRGAYGISAASKAYFDKPVEQLTVAEGALLAALIRRPSTLD
FT                   PAVDPEGAHARWNWVLDGMVETKALSPNDRAAQVFPETVPPDLARAENQTKGPNGLIER
FT                   QVTRELLELFNIDEQTLNTQGLVVTTTIDPQAQRAAEKAVAKYLDGQDPDMRAAVVSID
FT                   PHNGAVRAYYGGDNANGFDFAQAGLQTGSSFKVFALVAALEQGIGLGYQVDSSPLTVDG
FT                   IKITNVEGEGCGTCNIAEALKMSLNTSYYRLMLKLNGGPQAVADAAHQAGIASSFPGVA
FT                   HTLSEDGKGGPPNNGIVLGQYQTRVIDMASAYATLAASGIYHPPHFVQKVVSANGQVLF
FT                   DASTADNTGDQRIPKAVADNVTAAMEPIAGYSRGHNLAGGRDSAAKTGTTQFGDTTANK
FT                   DAWMVGYTPSLSTAVWVGTVKGDEPLVTASGAAIYGSGLPSDIWKATMDGALKGTSNET
FT                   FPKPTEVGGYAGVPPPPPPPSEVPPSETVIQPTVEIAPGITIPIGPPTTITLAPPPPAP
FT                   PAATPTPPP"
     MNSDGRHHQS SSGAPRGPAN PGQRGQVPPD DRLTAILPPV TDDRSAPHAD SIEAVKAALD        60
     GAPPMPPPRD PLEEVTAALA APPGKPPRGD QLGGRRRPPG PPGPPGSSGQ PAGRLPQPRV       120
     DLPRVGQINW KWIRRSLYLT AAVVILLPMV TFTMAYLIVD VPKPGDIRTN QVSTILASDG       180
     SEIAKIVPPE GNRVDVNLSQ VPMHVRQAVI AAEDRNFYSN PGFSFTGFAR AVKNNLFGGD       240
     LQGGSTITQQ YVKNALVGSA QHGWSGLMRK AKELVIATKM SGEWSKDDVL QAYLNIIYFG       300
     RGAYGISAAS KAYFDKPVEQ LTVAEGALLA ALIRRPSTLD PAVDPEGAHA RWNWVLDGMV       360
     ETKALSPNDR AAQVFPETVP PDLARAENQT KGPNGLIERQ VTRELLELFN IDEQTLNTQG       420
     LVVTTTIDPQ AQRAAEKAVA KYLDGQDPDM RAAVVSIDPH NGAVRAYYGG DNANGFDFAQ       480
     AGLQTGSSFK VFALVAALEQ GIGLGYQVDS SPLTVDGIKI TNVEGEGCGT CNIAEALKMS       540
     LNTSYYRLML KLNGGPQAVA DAAHQAGIAS SFPGVAHTLS EDGKGGPPNN GIVLGQYQTR       600
     VIDMASAYAT LAASGIYHPP HFVQKVVSAN GQVLFDASTA DNTGDQRIPK AVADNVTAAM       660
     EPIAGYSRGH NLAGGRDSAA KTGTTQFGDT TANKDAWMVG YTPSLSTAVW VGTVKGDEPL       720
     VTASGAAIYG SGLPSDIWKA TMDGALKGTS NETFPKPTEV GGYAGVPPPP PPPSEVPPSE       780
     TVIQPTVEIA PGITIPIGPP TTITLAPPPP APPAATPTPP P                           821
//

If you have problems or comments...

PBIL Back to PBIL home page