(data stored in ACNUC1104 zone)

EMBL: CP000717.PE495

CP000717.PE495       Location/Qualifiers
FT   CDS             579956..580507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10495"
FT                   /old_locus_tag="TBFG_00485"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0487"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10495"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04838"
FT                   /protein_id="ABR04838.1"
FT                   /translation="MTSSLPTVQRVIQNALEVSQLKYSQHPRPGGAPPALIVELPGERK
FT                   LKINTILSVGEHSVRVEAFVCRKPDENREDVYRFLLRRNRRLYGVAYTLDNVGDIYLVG
FT                   QMALSAVDADEVDRVLGQVLEVVDSDFNALLELGFRSSIQREWQWRLSRGESLQNLQAF
FT                   AHLRPTTMQSAQRDEKELGG"
     MTSSLPTVQR VIQNALEVSQ LKYSQHPRPG GAPPALIVEL PGERKLKINT ILSVGEHSVR        60
     VEAFVCRKPD ENREDVYRFL LRRNRRLYGV AYTLDNVGDI YLVGQMALSA VDADEVDRVL       120
     GQVLEVVDSD FNALLELGFR SSIQREWQWR LSRGESLQNL QAFAHLRPTT MQSAQRDEKE       180
     LGG                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page