(data stored in ACNUC1104 zone)

EMBL: CP000717.PE498

CP000717.PE498       Location/Qualifiers
FT   CDS             582518..583750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10498"
FT                   /old_locus_tag="TBFG_00488"
FT                   /product="two component system sensor histidine kinase
FT                   senX3"
FT                   /note="Mapped to H37Rv Rv0490"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10498"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04841"
FT                   /protein_id="ABR04841.1"
FT                   /translation="MTVFSALLLAGVLSALALAVGGAVGMRLTSRVVEQRQRVATEWSG
FT                   ITVSQMLQCIVTLMPLGAAVVDTHRDVVYLNERAKELGLVRDRQLDDQAWRAARQALGG
FT                   EDVEFDLSPRKRSATGRSGLSVHGHARLLSEEDRRFAVVFVHDQSDYARMEAARRDFVA
FT                   NVSHELKTPVGAMALLAEALLASADDSETVRRFAEKVLIEANRLGDMVAELIELSRLQG
FT                   AERLPNMTDVDVDTIVSEAISRHKVAADNADIEVRTDAPSNLRVLGDQTLLVTALANLV
FT                   SNAIAYSPRGSLVSISRRRRGANIEIAVTDRGIGIAPEDQERVFERFFRGDKARSRATG
FT                   GSGLGLAIVKHVAANHDGTIRVWSKPGTGSTFTLALPALIEAYHDDERPEQAREPELRS
FT                   NRSQREEELSR"
     MTVFSALLLA GVLSALALAV GGAVGMRLTS RVVEQRQRVA TEWSGITVSQ MLQCIVTLMP        60
     LGAAVVDTHR DVVYLNERAK ELGLVRDRQL DDQAWRAARQ ALGGEDVEFD LSPRKRSATG       120
     RSGLSVHGHA RLLSEEDRRF AVVFVHDQSD YARMEAARRD FVANVSHELK TPVGAMALLA       180
     EALLASADDS ETVRRFAEKV LIEANRLGDM VAELIELSRL QGAERLPNMT DVDVDTIVSE       240
     AISRHKVAAD NADIEVRTDA PSNLRVLGDQ TLLVTALANL VSNAIAYSPR GSLVSISRRR       300
     RGANIEIAVT DRGIGIAPED QERVFERFFR GDKARSRATG GSGLGLAIVK HVAANHDGTI       360
     RVWSKPGTGS TFTLALPALI EAYHDDERPE QAREPELRSN RSQREEELSR                  410
//

If you have problems or comments...

PBIL Back to PBIL home page