(data stored in ACNUC1104 zone)

EMBL: CP000717.PE5

CP000717.PE5         Location/Qualifiers
FT   CDS             5224..7368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10005"
FT                   /old_locus_tag="TBFG_00005"
FT                   /product="DNA gyrase subunit B gyrB"
FT                   /note="Mapped to H37Rv Rv0005"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10005"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04348"
FT                   /protein_id="ABR04348.1"
FT                   /translation="MGKNEARRSALAPDHGTVVCDPLRRLNRMHATPEESIRIVAAQKK
FT                   KAQDEYGAASITILEGLEAVRKRPGMYIGSTGERGLHHLIWEVVDNAVDEAMAGYATTV
FT                   NVVLLEDGGVEVADDGRGIPVATHASGILTVDVVMTQLHAGGKFDSDAYAISGGLHGVG
FT                   VSVVNALSTRLEVEIKRDGYEWSQVYEKSEPLGLKQGAPTKKTGSTVRFWADPAVFETT
FT                   EYDFETVARRLQEMAFLNKGLTINLTDERVTQDEVVDEVVSDVAEAPKSASERAAESTA
FT                   PHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSIVDFSGKGTGHEVEIAMQWNAGYSESV
FT                   HTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISV
FT                   KVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDAKVVVNKAVSSAQARIA
FT                   ARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAI
FT                   LPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDG
FT                   QHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLK
FT                   AGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGED
FT                   VDARRSFITRNAKDVRFLDV"
     MGKNEARRSA LAPDHGTVVC DPLRRLNRMH ATPEESIRIV AAQKKKAQDE YGAASITILE        60
     GLEAVRKRPG MYIGSTGERG LHHLIWEVVD NAVDEAMAGY ATTVNVVLLE DGGVEVADDG       120
     RGIPVATHAS GILTVDVVMT QLHAGGKFDS DAYAISGGLH GVGVSVVNAL STRLEVEIKR       180
     DGYEWSQVYE KSEPLGLKQG APTKKTGSTV RFWADPAVFE TTEYDFETVA RRLQEMAFLN       240
     KGLTINLTDE RVTQDEVVDE VVSDVAEAPK SASERAAEST APHKVKSRTF HYPGGLVDFV       300
     KHINRTKNAI HSSIVDFSGK GTGHEVEIAM QWNAGYSESV HTFANTINTH EGGTHEEGFR       360
     SALTSVVNKY AKDRKLLKDK DPNLTGDDIR EGLAAVISVK VSEPQFEGQT KTKLGNTEVK       420
     SFVQKVCNEQ LTHWFEANPT DAKVVVNKAV SSAQARIAAR KARELVRRKS ATDIGGLPGK       480
     LADCRSTDPR KSELYVVEGD SAGGSAKSGR DSMFQAILPL RGKIINVEKA RIDRVLKNTE       540
     VQAIITALGT GIHDEFDIGK LRYHKIVLMA DADVDGQHIS TLLLTLLFRF MRPLIENGHV       600
     FLAQPPLYKL KWQRSDPEFA YSDRERDGLL EAGLKAGKKI NKEDGIQRYK GLGEMDAKEL       660
     WETTMDPSVR VLRQVTLDDA AAADELFSIL MGEDVDARRS FITRNAKDVR FLDV             714
//

If you have problems or comments...

PBIL Back to PBIL home page