(data stored in ACNUC1104 zone)

EMBL: CP000717.PE503

CP000717.PE503       Location/Qualifiers
FT   CDS             587840..588568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10503"
FT                   /old_locus_tag="TBFG_00493"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   gntR-family"
FT                   /note="Mapped to H37Rv Rv0494"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10503"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04846"
FT                   /protein_id="ABR04846.1"
FT                   /translation="MVEPMNQSSVFQPPDRQRVDERIATTIADAILDGVFPPGSTLPPE
FT                   RDLAERLGVNRTSLRQGLARLQQMGLIEVRHGSGSVVRDPEGLTHPAVVEALVRKLGPD
FT                   FLVELLEIRAALGPLIGRLAAARSTPEDAEALCAALEVVQQADTAAARQAADLAYFRVL
FT                   IHSTRNRALGLLYRWVEHAFGGREHALTGAYDDADPVLTDLRAINGAVLAGDPAAAAAT
FT                   VEAYLNASALRMVKSYRDRA"
     MVEPMNQSSV FQPPDRQRVD ERIATTIADA ILDGVFPPGS TLPPERDLAE RLGVNRTSLR        60
     QGLARLQQMG LIEVRHGSGS VVRDPEGLTH PAVVEALVRK LGPDFLVELL EIRAALGPLI       120
     GRLAAARSTP EDAEALCAAL EVVQQADTAA ARQAADLAYF RVLIHSTRNR ALGLLYRWVE       180
     HAFGGREHAL TGAYDDADPV LTDLRAINGA VLAGDPAAAA ATVEAYLNAS ALRMVKSYRD       240
     RA                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page