(data stored in ACNUC1104 zone)

EMBL: CP000717.PE505

CP000717.PE505       Location/Qualifiers
FT   CDS             589491..590525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10505"
FT                   /old_locus_tag="TBFG_00495"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0496"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10505"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04848"
FT                   /protein_id="ABR04848.1"
FT                   /translation="MRLGVLDVGSNTVHLLVVDAHRGGHPTPMSSTKATLRLAEATDSS
FT                   GKITKRGADKLISTIDEFAKIAISSGCAELMAFATSAVRDAENSEDVLSRVRKETGVEL
FT                   QALRGEDESRLTFLAVRRWYGWSAGRILNLDIGGGSLEVSSGVDEEPEIALSLPLGAGR
FT                   LTREWLPDDPPGRRRVAMLRDWLDAELAEPSVTVLEAGSPDLAVATSKTFRSLARLTGA
FT                   APSMAGPRVKRTLTANGLRQLIAFISRMTAVDRAELEGVSADRAPQIVAGALVAEASMR
FT                   ALSIEAVEICPWALREGLILRKLDSEADGTALIESSSVHTSVRAVGGQPADRNAANRSR
FT                   GSKP"
     MRLGVLDVGS NTVHLLVVDA HRGGHPTPMS STKATLRLAE ATDSSGKITK RGADKLISTI        60
     DEFAKIAISS GCAELMAFAT SAVRDAENSE DVLSRVRKET GVELQALRGE DESRLTFLAV       120
     RRWYGWSAGR ILNLDIGGGS LEVSSGVDEE PEIALSLPLG AGRLTREWLP DDPPGRRRVA       180
     MLRDWLDAEL AEPSVTVLEA GSPDLAVATS KTFRSLARLT GAAPSMAGPR VKRTLTANGL       240
     RQLIAFISRM TAVDRAELEG VSADRAPQIV AGALVAEASM RALSIEAVEI CPWALREGLI       300
     LRKLDSEADG TALIESSSVH TSVRAVGGQP ADRNAANRSR GSKP                        344
//

If you have problems or comments...

PBIL Back to PBIL home page