(data stored in ACNUC1104 zone)

EMBL: CP000717.PE51

CP000717.PE51        Location/Qualifiers
FT   CDS             57514..58077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10051"
FT                   /old_locus_tag="TBFG_00051"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0052"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10051"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04394"
FT                   /protein_id="ABR04394.1"
FT                   /translation="MPSFDVVFVGHRRGEVRSDNAMLGLLCDAAFDELTRPDVVIFPGG
FT                   IGTRTLIHDQTVLDWVREAHRHTLLTTSVCTGGLVLAAAGLLNGLTATTHWRVQDLFNS
FT                   LGARYVPQRVVEHLPERVITAAGVSSGIDMGLRLVELLVSREAAEASQLMIEYDPQPPV
FT                   DAGSLAKASPATHRLALEFYQHRL"
     MPSFDVVFVG HRRGEVRSDN AMLGLLCDAA FDELTRPDVV IFPGGIGTRT LIHDQTVLDW        60
     VREAHRHTLL TTSVCTGGLV LAAAGLLNGL TATTHWRVQD LFNSLGARYV PQRVVEHLPE       120
     RVITAAGVSS GIDMGLRLVE LLVSREAAEA SQLMIEYDPQ PPVDAGSLAK ASPATHRLAL       180
     EFYQHRL                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page