(data stored in ACNUC1104 zone)

EMBL: CP000717.PE510

CP000717.PE510       Location/Qualifiers
FT   CDS             594256..594492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10510"
FT                   /old_locus_tag="TBFG_00500"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0500A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10510"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04853"
FT                   /protein_id="ABR04853.1"
FT                   /translation="MTSTNGPSARDTGFVEGQQAKTQLLTVAEVAALMRVSKMTVYRLV
FT                   HNGELPAVRVGRSFRVHAKAVHDMLETSYFDAG"
     MTSTNGPSAR DTGFVEGQQA KTQLLTVAEV AALMRVSKMT VYRLVHNGEL PAVRVGRSFR        60
     VHAKAVHDML ETSYFDAG                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page