(data stored in ACNUC1104 zone)

EMBL: CP000717.PE52

CP000717.PE52        Location/Qualifiers
FT   CDS             58296..58586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10052"
FT                   /old_locus_tag="TBFG_00052"
FT                   /product="30S ribosomal protein S6 rpsF"
FT                   /note="Mapped to H37Rv Rv0053"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10052"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04395"
FT                   /protein_id="ABR04395.1"
FT                   /translation="MRPYEIMVILDPTLDERTVAPSLETFLNVVRKDGGKVEKVDIWGK
FT                   RRLAYEIAKHAEGIYVVIDVKAAPATVSELDRQLSLNESVLRTKVMRTDKH"
     MRPYEIMVIL DPTLDERTVA PSLETFLNVV RKDGGKVEKV DIWGKRRLAY EIAKHAEGIY        60
     VVIDVKAAPA TVSELDRQLS LNESVLRTKV MRTDKH                                  96
//

If you have problems or comments...

PBIL Back to PBIL home page