(data stored in ACNUC1104 zone)

EMBL: CP000717.PE524

CP000717.PE524       Location/Qualifiers
FT   CDS             608749..609297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10524"
FT                   /old_locus_tag="TBFG_00513"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0513"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10524"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04867"
FT                   /protein_id="ABR04867.1"
FT                   /translation="MTPTGDTKPKLLFYEPGASWYWVLTGPLAAVSVLLLEISSGAGVG
FT                   LITPAIFLVMVSAFVALQVKAARIHTSVELTHDALRQGTETIRLAEIVKIYPEADGRET
FT                   SGEEPAKWQSARTLGELVGVPRGRVGIGLKLTGGRTAQAWARRHQQLRAALTPLVQERL
FT                   GPVDSDVADVNGDDAGPAR"
     MTPTGDTKPK LLFYEPGASW YWVLTGPLAA VSVLLLEISS GAGVGLITPA IFLVMVSAFV        60
     ALQVKAARIH TSVELTHDAL RQGTETIRLA EIVKIYPEAD GRETSGEEPA KWQSARTLGE       120
     LVGVPRGRVG IGLKLTGGRT AQAWARRHQQ LRAALTPLVQ ERLGPVDSDV ADVNGDDAGP       180
     AR                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page