(data stored in ACNUC1104 zone)

EMBL: CP000717.PE526

CP000717.PE526       Location/Qualifiers
FT   CDS             609740..611206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10526"
FT                   /old_locus_tag="TBFG_00515"
FT                   /product="13E12 repeat family protein"
FT                   /note="Mapped to H37Rv Rv0515"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10526"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04869"
FT                   /protein_id="ABR04869.1"
FT                   /translation="MPCSADHEGVGGVHRSDLLGDSGRKPGRCGAVGGVGGVVRLSVVA
FT                   LRGREEWVMDTMAAVAAEVAAALRISQGLAASRLRYARAMRERLPKTAEVFSAGDIGYL
FT                   MFATIVYRTDLIVDPDVLAAVDAQLAANVARWPSMTKARLAGQVDKIVARADADAVRRR
FT                   KEYQAQRQFWVGESQDGVCQIGGSLLAVDAHALDARLSALAGTVCEHDPRSREQRRADA
FT                   LGALAGGADRLGCGCGRADCAAGKRPAAPPVVIHLIAEAATINGTGSAPASQMNADGLI
FT                   TAELVAELAKTATLVPLVHPGDAPPEPGYAPSKALADFVRCRDLTCRWPGCDEPATNCD
FT                   LDHTIPYAAGGPTHASNLKCYCRTHHLVKTFWGWRDQQLPDGTLILTSPSGHTYVSTPG
FT                   SALLFPSLCHFSGGIPAPEADPPYDHCDQRTAMMPKRRRTRAQDRAYRIATERRQNHAA
FT                   RQRAQVLTQTAAATDTHGPPPDHNDDPPPF"
     MPCSADHEGV GGVHRSDLLG DSGRKPGRCG AVGGVGGVVR LSVVALRGRE EWVMDTMAAV        60
     AAEVAAALRI SQGLAASRLR YARAMRERLP KTAEVFSAGD IGYLMFATIV YRTDLIVDPD       120
     VLAAVDAQLA ANVARWPSMT KARLAGQVDK IVARADADAV RRRKEYQAQR QFWVGESQDG       180
     VCQIGGSLLA VDAHALDARL SALAGTVCEH DPRSREQRRA DALGALAGGA DRLGCGCGRA       240
     DCAAGKRPAA PPVVIHLIAE AATINGTGSA PASQMNADGL ITAELVAELA KTATLVPLVH       300
     PGDAPPEPGY APSKALADFV RCRDLTCRWP GCDEPATNCD LDHTIPYAAG GPTHASNLKC       360
     YCRTHHLVKT FWGWRDQQLP DGTLILTSPS GHTYVSTPGS ALLFPSLCHF SGGIPAPEAD       420
     PPYDHCDQRT AMMPKRRRTR AQDRAYRIAT ERRQNHAARQ RAQVLTQTAA ATDTHGPPPD       480
     HNDDPPPF                                                                488
//

If you have problems or comments...

PBIL Back to PBIL home page