(data stored in ACNUC1104 zone)

EMBL: CP000717.PE53

CP000717.PE53        Location/Qualifiers
FT   CDS             58690..59184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10053"
FT                   /old_locus_tag="TBFG_00053"
FT                   /product="single-strand binding protein ssb
FT                   (helix-destabilizing protein)"
FT                   /note="Mapped to H37Rv Rv0054"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10053"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04396"
FT                   /protein_id="ABR04396.1"
FT                   /translation="MAGDTTITIVGNLTADPELRFTPSGAAVANFTVASTPRIYDRQTG
FT                   EWKDGEALFLRCNIWREAAENVAESLTRGARVIVSGRLKQRSFETREGEKRTVIEVEVD
FT                   EIGPSLRYATAKVNKASRSGGFGSGSRPAPAQTSSASGDDPWGSAPASGSFGGGDDEPP
FT                   F"
     MAGDTTITIV GNLTADPELR FTPSGAAVAN FTVASTPRIY DRQTGEWKDG EALFLRCNIW        60
     REAAENVAES LTRGARVIVS GRLKQRSFET REGEKRTVIE VEVDEIGPSL RYATAKVNKA       120
     SRSGGFGSGS RPAPAQTSSA SGDDPWGSAP ASGSFGGGDD EPPF                        164
//

If you have problems or comments...

PBIL Back to PBIL home page