(data stored in ACNUC1104 zone)

EMBL: CP000717.PE530

CP000717.PE530       Location/Qualifiers
FT   CDS             complement(614316..615218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10530"
FT                   /old_locus_tag="TBFG_00519"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0519c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10530"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04873"
FT                   /protein_id="ABR04873.1"
FT                   /translation="MLRRGCAGNTDRRGIMTPMADLTRRALLRWGAGAGAGAAGVWAFG
FT                   ALVDPLEPQAAPAPFEPPTAGSSLPTRISGSFISAARGGIKTNWVISMPPGQSGQLRPV
FT                   IALHGKDGNAGMMLDLGVEQGLARLVKEGKPAFAVVGVDGGNTYWHRRSSGGDSGAMVL
FT                   DELLPMLTSMGMDTSRVGFLGWSMGGYGALLLGARLGPARTAGICAISPALFTSFTGST
FT                   PGAFDSYDDYVQHSVLGLPALNSIPLRVDCGTSDRFYFATRQFVNQLHQPPAGSFSPGG
FT                   HDASYWREQLPGELAWMAS"
     MLRRGCAGNT DRRGIMTPMA DLTRRALLRW GAGAGAGAAG VWAFGALVDP LEPQAAPAPF        60
     EPPTAGSSLP TRISGSFISA ARGGIKTNWV ISMPPGQSGQ LRPVIALHGK DGNAGMMLDL       120
     GVEQGLARLV KEGKPAFAVV GVDGGNTYWH RRSSGGDSGA MVLDELLPML TSMGMDTSRV       180
     GFLGWSMGGY GALLLGARLG PARTAGICAI SPALFTSFTG STPGAFDSYD DYVQHSVLGL       240
     PALNSIPLRV DCGTSDRFYF ATRQFVNQLH QPPAGSFSPG GHDASYWREQ LPGELAWMAS       300
//

If you have problems or comments...

PBIL Back to PBIL home page