(data stored in ACNUC1104 zone)

EMBL: CP000717.PE540

CP000717.PE540       Location/Qualifiers
FT   CDS             623035..624009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10540"
FT                   /old_locus_tag="TBFG_00529"
FT                   /product="cytochrome C-type biogenesis protein ccsA"
FT                   /note="Mapped to H37Rv Rv0529"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10540"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04883"
FT                   /protein_id="ABR04883.1"
FT                   /translation="MNTLHVNVGLARYSDWAFTSAVVALVVALLLLAFEFAQVRGRGLA
FT                   PLAVPAGSVATDSATPGIVADQRHRPFDERVGRGGLAVAYLGIGLLLACVVLRGLATQR
FT                   VPWGNMYEFINLTCLSGLIAGAVVLRRARYRPLWVFLLVPVLILLTVSGRWLYANAAPV
FT                   MPALQSYWLPIHVSVVSLGSGVFLVAGVASILFLVRTSRLGEPTGEGALAGMVRRLPDA
FT                   QTLDGIAYRTTIFAFPVFGFGVIFGAIWAEEAWGRYWGWDPKETVSFVAWVVYAAYLHA
FT                   RSTAGWRDRKAAWINVAGFVAMVFNLFFVNLVTVGLHSYAGVG"
     MNTLHVNVGL ARYSDWAFTS AVVALVVALL LLAFEFAQVR GRGLAPLAVP AGSVATDSAT        60
     PGIVADQRHR PFDERVGRGG LAVAYLGIGL LLACVVLRGL ATQRVPWGNM YEFINLTCLS       120
     GLIAGAVVLR RARYRPLWVF LLVPVLILLT VSGRWLYANA APVMPALQSY WLPIHVSVVS       180
     LGSGVFLVAG VASILFLVRT SRLGEPTGEG ALAGMVRRLP DAQTLDGIAY RTTIFAFPVF       240
     GFGVIFGAIW AEEAWGRYWG WDPKETVSFV AWVVYAAYLH ARSTAGWRDR KAAWINVAGF       300
     VAMVFNLFFV NLVTVGLHSY AGVG                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page