(data stored in ACNUC1104 zone)

EMBL: CP000717.PE543

CP000717.PE543       Location/Qualifiers
FT   CDS             625937..627805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10543"
FT                   /old_locus_tag="TBFG_00533"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0532"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10543"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04886"
FT                   /protein_id="ABR04886.1"
FT                   /translation="MSNLLVTPELVAAAAADLAGIGSAIGAANAAAGAPTMALLAAGAD
FT                   EVSAAVAAVFSSYAQQYQALSAAAAAFHDQFVRALAAGAGAYAGAEAANVEQQLLNAIN
FT                   APTLALLGRPLIGNGADGAAGTGQAGGAGGLLYGNGGNGGSGAAGQAGGAGGAAGLIGH
FT                   GGTGGVGGTGAAGGAGGTGGWLFGNGGAGGTGGAVTGVSTTGGPGGHGGDAGLYGFGGA
FT                   GGAGGFGQSGAAGGAGGAGGWLYGDGGDGGAGGNGGNESGTGVSGVGGVGGAGGAGGLL
FT                   FGNGGDGGVGGDGGDGSSTQDSGGDGGAGGAGGAGGWLLGNGGAGGAGGAASIKVATGG
FT                   LGGDGGDAGLFGFGGDGGWGGRGVDARFGAAGGAAGAGGAGGWLYGDGGAGGVGGVGGA
FT                   VFSLSSGDGGAGGAGGGGGWLFGNGGDGGAGGGGGGRFGSGSGAGGDGAVGGAGGAGAW
FT                   FGNGGAGGVGGGGGRGTTAIGGDGGAGGAGGAGGWLYGDGGAGGAGGGGGRGGTGNDGG
FT                   DGGDGGRGGDAQLLGNGGDGGAGGAGGPAGLALPPGPARPAGAAVPAVRCSAAPARPAR
FT                   TADPWLAPIFARSTLRHSHHLGGIAQTGAVADQQGQIAGLGRAGRQ"
     MSNLLVTPEL VAAAAADLAG IGSAIGAANA AAGAPTMALL AAGADEVSAA VAAVFSSYAQ        60
     QYQALSAAAA AFHDQFVRAL AAGAGAYAGA EAANVEQQLL NAINAPTLAL LGRPLIGNGA       120
     DGAAGTGQAG GAGGLLYGNG GNGGSGAAGQ AGGAGGAAGL IGHGGTGGVG GTGAAGGAGG       180
     TGGWLFGNGG AGGTGGAVTG VSTTGGPGGH GGDAGLYGFG GAGGAGGFGQ SGAAGGAGGA       240
     GGWLYGDGGD GGAGGNGGNE SGTGVSGVGG VGGAGGAGGL LFGNGGDGGV GGDGGDGSST       300
     QDSGGDGGAG GAGGAGGWLL GNGGAGGAGG AASIKVATGG LGGDGGDAGL FGFGGDGGWG       360
     GRGVDARFGA AGGAAGAGGA GGWLYGDGGA GGVGGVGGAV FSLSSGDGGA GGAGGGGGWL       420
     FGNGGDGGAG GGGGGRFGSG SGAGGDGAVG GAGGAGAWFG NGGAGGVGGG GGRGTTAIGG       480
     DGGAGGAGGA GGWLYGDGGA GGAGGGGGRG GTGNDGGDGG DGGRGGDAQL LGNGGDGGAG       540
     GAGGPAGLAL PPGPARPAGA AVPAVRCSAA PARPARTADP WLAPIFARST LRHSHHLGGI       600
     AQTGAVADQQ GQIAGLGRAG RQ                                                622
//

If you have problems or comments...

PBIL Back to PBIL home page