(data stored in ACNUC1104 zone)

EMBL: CP000717.PE551

CP000717.PE551       Location/Qualifiers
FT   CDS             635600..636262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10551"
FT                   /old_locus_tag="TBFG_00541"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0540"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10551"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04894"
FT                   /protein_id="ABR04894.1"
FT                   /translation="MSCLPVSVLVVAKAPEPGRVKTRLAAAIGDKVAADIAAAALLDTL
FT                   DAVAAAPVTARAVALTGDLDSAADSAEIRRRLKSFTVFRQRGDAFADRLANAHVDAADG
FT                   YPVLQIGMDTPQVTAELLADCARLLLQIPAVLGLAFDGGWWVLGIRTPTAAECLRAVPM
FT                   SQPDTGELTLKALRDNGIDVTLVQRLGDFDIVDDIALVRDCCAPGSRFAQATRAAGL"
     MSCLPVSVLV VAKAPEPGRV KTRLAAAIGD KVAADIAAAA LLDTLDAVAA APVTARAVAL        60
     TGDLDSAADS AEIRRRLKSF TVFRQRGDAF ADRLANAHVD AADGYPVLQI GMDTPQVTAE       120
     LLADCARLLL QIPAVLGLAF DGGWWVLGIR TPTAAECLRA VPMSQPDTGE LTLKALRDNG       180
     IDVTLVQRLG DFDIVDDIAL VRDCCAPGSR FAQATRAAGL                             220
//

If you have problems or comments...

PBIL Back to PBIL home page