(data stored in ACNUC1104 zone)

EMBL: CP000717.PE556

CP000717.PE556       Location/Qualifiers
FT   CDS             complement(639438..640691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10556"
FT                   /old_locus_tag="TBFG_00546"
FT                   /product="low affinity inorganic phosphate transporter
FT                   integral membrane protein pitA"
FT                   /note="Mapped to H37Rv Rv0545c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10556"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04899"
FT                   /protein_id="ABR04899.1"
FT                   /translation="MNLQLFLLLIVVVTALAFDFTNGFHDTGNAMATSIASGALAPRVA
FT                   VALSAVLNLIGAFLSTAVAATIAKGLIDANLVTLELVFAGLVGGIVWNLLTWLLGIPSS
FT                   SSHALIGGIVGATIAAVGLRGVIWSGVVSKVIVPAVVAALLATLVGAVGTWLVYRTTRG
FT                   VAEKRTERGFRRGQIGSASLVSLAHGTNDAQKTMGVIFLALMSYGAVSTTASVPPLWVI
FT                   VSCAVAMAAGTYLGGWRIIRTLGKGLVEIKPPQGMAAESSSAAVILLSAHFGYALSTTQ
FT                   VATGSVLGSGVGKPGAEVRWGVAGRMVVAWLVTLPLAGLVGAFTYGLVHFIGGYPGAIL
FT                   GFALLWLTATAIWLRSRRAPIDHTNVNADWEGNLTAGLEAGAQPLADQRPPVPAPPAPT
FT                   PPPNHRAPQFGVTTRNAP"
     MNLQLFLLLI VVVTALAFDF TNGFHDTGNA MATSIASGAL APRVAVALSA VLNLIGAFLS        60
     TAVAATIAKG LIDANLVTLE LVFAGLVGGI VWNLLTWLLG IPSSSSHALI GGIVGATIAA       120
     VGLRGVIWSG VVSKVIVPAV VAALLATLVG AVGTWLVYRT TRGVAEKRTE RGFRRGQIGS       180
     ASLVSLAHGT NDAQKTMGVI FLALMSYGAV STTASVPPLW VIVSCAVAMA AGTYLGGWRI       240
     IRTLGKGLVE IKPPQGMAAE SSSAAVILLS AHFGYALSTT QVATGSVLGS GVGKPGAEVR       300
     WGVAGRMVVA WLVTLPLAGL VGAFTYGLVH FIGGYPGAIL GFALLWLTAT AIWLRSRRAP       360
     IDHTNVNADW EGNLTAGLEA GAQPLADQRP PVPAPPAPTP PPNHRAPQFG VTTRNAP          417
//

If you have problems or comments...

PBIL Back to PBIL home page