(data stored in ACNUC1104 zone)

EMBL: CP000717.PE56

CP000717.PE56        Location/Qualifiers
FT   CDS             60000..60521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10056"
FT                   /old_locus_tag="TBFG_00056"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0057"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10056"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04399"
FT                   /protein_id="ABR04399.1"
FT                   /translation="MPVVTAVGRRRGFAMPWVSTARSGAVMLANYSAGVCGRVSSPGLN
FT                   VRKMCLKANTPGAVTWLDTPKRFLSTQTASRCMAVNSSDVVTGRIDPQVLHTPLNTDVD
FT                   GYAHAMHSSINSGPLEYLPATFSVFPALGDVGDLGGGVGAATYALDRLSNMRSGACVGG
FT                   GESPWRSLMT"
     MPVVTAVGRR RGFAMPWVST ARSGAVMLAN YSAGVCGRVS SPGLNVRKMC LKANTPGAVT        60
     WLDTPKRFLS TQTASRCMAV NSSDVVTGRI DPQVLHTPLN TDVDGYAHAM HSSINSGPLE       120
     YLPATFSVFP ALGDVGDLGG GVGAATYALD RLSNMRSGAC VGGGESPWRS LMT              173
//

If you have problems or comments...

PBIL Back to PBIL home page