(data stored in ACNUC1104 zone)

EMBL: CP000717.PE562

CP000717.PE562       Location/Qualifiers
FT   CDS             646108..647721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10562"
FT                   /old_locus_tag="TBFG_00553"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0552"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10562"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04905"
FT                   /protein_id="ABR04905.1"
FT                   /translation="MEPMADADLVMTGTVLTVDDARPTAEAIAVADGRVIAVGDRSEVA
FT                   GLVGANTRVIDLGAGCVMPGFVEAHGHPLLEAVVLSDRFVDIRPVTMRDADDVVAAIRG
FT                   EVARRGPAGAYLVGWDPLLQSGLGEPTLTWLDSLAPNGPLVIIHNSGHKAYFNSHAAWL
FT                   NGLTRDTADPKGAKYGRDGNGELDGTAEEIGAILPLLAGVADPSNFGAMLRAECARLNR
FT                   AGLTTCSEMAFDPGYRPMVEAVRAELTVRLCTYEISNARMCTDATPGQGDDMLRQVGIK
FT                   IWVDGSPWVGNIDLTFPYLDTPATRAIGVPPGSRGCANYTREQLAEIVGAYFPRGWQIA
FT                   CHVHGDGGVDTILDVYEEALRRNPRDDHRLRLEHVGAIRPDQLRRAAELGVTCSIFVDQ
FT                   IHYWGDVIVDDLFGAQRGSRWMPAGSAVAAGMRISLHNDPPVTPEEPLRNISVAATRVA
FT                   PSGRVLAPEERLTVEQAIRAQTIDAAWQLFAEDAIGSLQVGKYADMVVLSADPRTVPPE
FT                   QIADLAVRATFLAGRQVYRR"
     MEPMADADLV MTGTVLTVDD ARPTAEAIAV ADGRVIAVGD RSEVAGLVGA NTRVIDLGAG        60
     CVMPGFVEAH GHPLLEAVVL SDRFVDIRPV TMRDADDVVA AIRGEVARRG PAGAYLVGWD       120
     PLLQSGLGEP TLTWLDSLAP NGPLVIIHNS GHKAYFNSHA AWLNGLTRDT ADPKGAKYGR       180
     DGNGELDGTA EEIGAILPLL AGVADPSNFG AMLRAECARL NRAGLTTCSE MAFDPGYRPM       240
     VEAVRAELTV RLCTYEISNA RMCTDATPGQ GDDMLRQVGI KIWVDGSPWV GNIDLTFPYL       300
     DTPATRAIGV PPGSRGCANY TREQLAEIVG AYFPRGWQIA CHVHGDGGVD TILDVYEEAL       360
     RRNPRDDHRL RLEHVGAIRP DQLRRAAELG VTCSIFVDQI HYWGDVIVDD LFGAQRGSRW       420
     MPAGSAVAAG MRISLHNDPP VTPEEPLRNI SVAATRVAPS GRVLAPEERL TVEQAIRAQT       480
     IDAAWQLFAE DAIGSLQVGK YADMVVLSAD PRTVPPEQIA DLAVRATFLA GRQVYRR          537
//

If you have problems or comments...

PBIL Back to PBIL home page