(data stored in ACNUC1104 zone)

EMBL: CP000717.PE58

CP000717.PE58        Location/Qualifiers
FT   CDS             63304..63996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10058"
FT                   /old_locus_tag="TBFG_00058"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0059"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10058"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04401"
FT                   /protein_id="ABR04401.1"
FT                   /translation="MITRYKPESGFVARSGGPDRKRPHDWIVWHFTHADNLPGIITAGR
FT                   LLADSAVTPTTEVAYNPVKELRRHKVVAPDSRYPASMASDHVPFYIAARSPMLYVVCKG
FT                   HSGYSGGAGPLVHLGVALGDIIDADLTWCASDGNAAASYTKFSRQVDTLGTFVDFDLLC
FT                   QRQWHNTDDDPNRQSRRAAEILVYGHVLFELVSYVCCYNTETMTRVRTLLDPVGGVRKY
FT                   VIKPGMYY"
     MITRYKPESG FVARSGGPDR KRPHDWIVWH FTHADNLPGI ITAGRLLADS AVTPTTEVAY        60
     NPVKELRRHK VVAPDSRYPA SMASDHVPFY IAARSPMLYV VCKGHSGYSG GAGPLVHLGV       120
     ALGDIIDADL TWCASDGNAA ASYTKFSRQV DTLGTFVDFD LLCQRQWHNT DDDPNRQSRR       180
     AAEILVYGHV LFELVSYVCC YNTETMTRVR TLLDPVGGVR KYVIKPGMYY                  230
//

If you have problems or comments...

PBIL Back to PBIL home page