(data stored in ACNUC1104 zone)

EMBL: CP000717.PE583

CP000717.PE583       Location/Qualifiers
FT   CDS             complement(669079..670470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10583"
FT                   /old_locus_tag="TBFG_00574"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0573c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10583"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04926"
FT                   /protein_id="ABR04926.1"
FT                   /translation="MAIRQHVGALFTDLYEVTMAQAYWAERMSGTAVFEIFFRKLPPGR
FT                   SYIMAAGLADVVEFLEAFRFDEQDLRYLRGLGQFSDEFLRWLAGVRFTGDVWAAPEGTV
FT                   IFPNEPAVQLIAPIIEAQLVETFVLNQIHLQSVLASKAARVVAAARGRPVVDFGARRAH
FT                   GTDAACKVARTSYLAGAAGTSNLLAARQYGIPTFGTMAHSFVQAFDSEVAAFEAFARLY
FT                   PATMLLVDTYDTLRGVDHVIELAKRLGNRFDVRAVRLDSGDLDELSKATRARLDTAGLE
FT                   QVEIFASSGLDENRIAALLAARCPIDGFGVGTQLVVAQDAPALDMAYKLVAYDGSGRTK
FT                   FSSGKVIYPGRKQVFRKLEHGVFCGDTLGEHGENLPGDPLLVPIMTNGRRIRQHAPTLD
FT                   GARDWARQQIDALPPELRSLEDTGYSYPVAVSDRIVGELARLRHADTAEAHPGSNVVGA
FT                   KAKRP"
     MAIRQHVGAL FTDLYEVTMA QAYWAERMSG TAVFEIFFRK LPPGRSYIMA AGLADVVEFL        60
     EAFRFDEQDL RYLRGLGQFS DEFLRWLAGV RFTGDVWAAP EGTVIFPNEP AVQLIAPIIE       120
     AQLVETFVLN QIHLQSVLAS KAARVVAAAR GRPVVDFGAR RAHGTDAACK VARTSYLAGA       180
     AGTSNLLAAR QYGIPTFGTM AHSFVQAFDS EVAAFEAFAR LYPATMLLVD TYDTLRGVDH       240
     VIELAKRLGN RFDVRAVRLD SGDLDELSKA TRARLDTAGL EQVEIFASSG LDENRIAALL       300
     AARCPIDGFG VGTQLVVAQD APALDMAYKL VAYDGSGRTK FSSGKVIYPG RKQVFRKLEH       360
     GVFCGDTLGE HGENLPGDPL LVPIMTNGRR IRQHAPTLDG ARDWARQQID ALPPELRSLE       420
     DTGYSYPVAV SDRIVGELAR LRHADTAEAH PGSNVVGAKA KRP                         463
//

If you have problems or comments...

PBIL Back to PBIL home page