(data stored in ACNUC1104 zone)

EMBL: CP000717.PE584

CP000717.PE584       Location/Qualifiers
FT   CDS             complement(670480..671622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10584"
FT                   /old_locus_tag="TBFG_00575"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0574c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10584"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04927"
FT                   /protein_id="ABR04927.1"
FT                   /translation="MAGNPDVVTVLLGGDVMLGRGVDQILPHPGKPQLRERYMRDATGY
FT                   VRLAERVNGRIPLPVDWRWPWGEALAVLENTATDVCLINLETTITADGEFADRKPVCYR
FT                   MHPDNVPALTALRPHVCALANNHILDFGYQGLTDTVAALAGAGIQSVGAGADLLAARRS
FT                   ALVTVGHERRVIVGSVAAESSGVPESWAARRDRPGVWLIRDPAQRDVADDVAAQVLADK
FT                   RPGDIAIVSMHWGSNWGYATAPGDVAFAHRLIDAGIDMVHGHSSHHPRPIEIYRGKPIL
FT                   YGCGDVVDDYEGIGGHESFRSELRLLYLTVTDPASGNLISLQMLPLRVSRMRLQRASQT
FT                   DTEWLRNTIERISRRFGIRVVTRPDNLLEVVPAANLTSKE"
     MAGNPDVVTV LLGGDVMLGR GVDQILPHPG KPQLRERYMR DATGYVRLAE RVNGRIPLPV        60
     DWRWPWGEAL AVLENTATDV CLINLETTIT ADGEFADRKP VCYRMHPDNV PALTALRPHV       120
     CALANNHILD FGYQGLTDTV AALAGAGIQS VGAGADLLAA RRSALVTVGH ERRVIVGSVA       180
     AESSGVPESW AARRDRPGVW LIRDPAQRDV ADDVAAQVLA DKRPGDIAIV SMHWGSNWGY       240
     ATAPGDVAFA HRLIDAGIDM VHGHSSHHPR PIEIYRGKPI LYGCGDVVDD YEGIGGHESF       300
     RSELRLLYLT VTDPASGNLI SLQMLPLRVS RMRLQRASQT DTEWLRNTIE RISRRFGIRV       360
     VTRPDNLLEV VPAANLTSKE                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page