(data stored in ACNUC1104 zone)

EMBL: CP000717.PE588

CP000717.PE588       Location/Qualifiers
FT   CDS             complement(675224..679144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10588"
FT                   /old_locus_tag="TBFG_00579"
FT                   /product="PE-PGRS family protein"
FT                   /note="Mapped to H37Rv Rv0578c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10588"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04932"
FT                   /protein_id="ABR04932.1"
FT                   /translation="MSFVIATPEMLTTAATDLAKIGSTITAANTAAAAVAKVLPASADE
FT                   VSVAVAALFGTHAQEYQTVSAQVATFHDRFVQTLSAAASSYVAAEAVNVEQSLLAAVNA
FT                   PTQALFGRPLIGNGADGSPGTGQAGGPGGILYGNGGNGGSGAPGQRGGAGGAAGLIGNG
FT                   GNGGAGGVGTTGGAGGHGGAGGWLYGNGGAGGFGGAGAVGGNGGAGGTAGLFGVGGAGG
FT                   AGGNGIAGVTGTSASTPGGSGTAGGAGGIGGNGGAGGAGGVLMGNGGNGGAGGEGGPGG
FT                   AGGAGASGAHATNLGADGQAGGNGGNGGAGGTGGVGGPGGGHGLLGLGGSHGAGGAGGS
FT                   GGDGGAPGDGGNGATGTWGHNLGAGGTGGNGGNPGAGGAGGAGGASVGGSAHGANGAPG
FT                   TTSTSGGNGGDGGKGADAISSGQTGANGGRGGDGGQVGNGGAGGAGGRGGAGGLGFGSE
FT                   APGRPGGAGGTGGAGGNGGTQAGDGGTGGAGGAGGDGGSGGAGSIGFNASAPGAAGSPG
FT                   GNGGNGGPGGAGGEGGAGGLALAASGQNGSQGAGGDGGAGGNGGTPGNGGHGAAGALGV
FT                   NGGVGGAGGHGGDPGVGGAGGQGGSGSTPGANGAPGNTPTSGGNGGNGGRGADATGFGQ
FT                   TGASGGRGGDGGLVGNGGAGGAGGNGSKGLPGLGRLGNPGLDGGTGGNGGAGGSGGAWA
FT                   GNGGTGGAGGTGGVGGTGGSGSDGVNGSSAGADGHPGGTGGVGGTGGKGGDGGDGGAAP
FT                   NGVAGSQGPGGAGGDGGTGGVGGNGGRGIDGADGATAGARGQDGGAGGAGGKGGRGGTG
FT                   GPGGAGPAGTTGSQGAGGNGGSGGTGGDPGDGGNGANGSVFTNNGIGGNGGNGGNAGPS
FT                   GAGGSGGAGSTFGATGSSSSIHVNGGNGGNGGNGDHALSGNGAAGGNGGNGGNGSLRGS
FT                   GGAGGHGGNGGNASRGMGGDGGTGGAGGNAGQIGNGGAGGNGGDGGTGSDGNPGAITGS
FT                   GGRGGDGGVGGQGGSVAGDGADGGRGGAGGTGGTGLRGTTGATGATGTFDAGADGHGGN
FT                   GGTGGVGGTGGAGGGGGNGGAGGKALSPTGNNGSQGAGGDGGAGGAGGTGGTGGDGGRG
FT                   AHGTLFSSLAGTGGTGGNGGTGGTGGTGGAGGAGGTGSTLGATGATGAAGRAGNGGVGG
FT                   SGGLGSAFGPGGTGGMGGAGGTSTVSAGGDGGRGGFGGDGLDASSGGNGGDGGHGGDGF
FT                   RTAGAGGRGGDGGKGADPGGLFPIPGAGGKGGTGGTGGTAHLGPLAIIGQSGQPGQFGS
FT                   PGADGRGGAGGAGGGGGAGGSF"
     MSFVIATPEM LTTAATDLAK IGSTITAANT AAAAVAKVLP ASADEVSVAV AALFGTHAQE        60
     YQTVSAQVAT FHDRFVQTLS AAASSYVAAE AVNVEQSLLA AVNAPTQALF GRPLIGNGAD       120
     GSPGTGQAGG PGGILYGNGG NGGSGAPGQR GGAGGAAGLI GNGGNGGAGG VGTTGGAGGH       180
     GGAGGWLYGN GGAGGFGGAG AVGGNGGAGG TAGLFGVGGA GGAGGNGIAG VTGTSASTPG       240
     GSGTAGGAGG IGGNGGAGGA GGVLMGNGGN GGAGGEGGPG GAGGAGASGA HATNLGADGQ       300
     AGGNGGNGGA GGTGGVGGPG GGHGLLGLGG SHGAGGAGGS GGDGGAPGDG GNGATGTWGH       360
     NLGAGGTGGN GGNPGAGGAG GAGGASVGGS AHGANGAPGT TSTSGGNGGD GGKGADAISS       420
     GQTGANGGRG GDGGQVGNGG AGGAGGRGGA GGLGFGSEAP GRPGGAGGTG GAGGNGGTQA       480
     GDGGTGGAGG AGGDGGSGGA GSIGFNASAP GAAGSPGGNG GNGGPGGAGG EGGAGGLALA       540
     ASGQNGSQGA GGDGGAGGNG GTPGNGGHGA AGALGVNGGV GGAGGHGGDP GVGGAGGQGG       600
     SGSTPGANGA PGNTPTSGGN GGNGGRGADA TGFGQTGASG GRGGDGGLVG NGGAGGAGGN       660
     GSKGLPGLGR LGNPGLDGGT GGNGGAGGSG GAWAGNGGTG GAGGTGGVGG TGGSGSDGVN       720
     GSSAGADGHP GGTGGVGGTG GKGGDGGDGG AAPNGVAGSQ GPGGAGGDGG TGGVGGNGGR       780
     GIDGADGATA GARGQDGGAG GAGGKGGRGG TGGPGGAGPA GTTGSQGAGG NGGSGGTGGD       840
     PGDGGNGANG SVFTNNGIGG NGGNGGNAGP SGAGGSGGAG STFGATGSSS SIHVNGGNGG       900
     NGGNGDHALS GNGAAGGNGG NGGNGSLRGS GGAGGHGGNG GNASRGMGGD GGTGGAGGNA       960
     GQIGNGGAGG NGGDGGTGSD GNPGAITGSG GRGGDGGVGG QGGSVAGDGA DGGRGGAGGT      1020
     GGTGLRGTTG ATGATGTFDA GADGHGGNGG TGGVGGTGGA GGGGGNGGAG GKALSPTGNN      1080
     GSQGAGGDGG AGGAGGTGGT GGDGGRGAHG TLFSSLAGTG GTGGNGGTGG TGGTGGAGGA      1140
     GGTGSTLGAT GATGAAGRAG NGGVGGSGGL GSAFGPGGTG GMGGAGGTST VSAGGDGGRG      1200
     GFGGDGLDAS SGGNGGDGGH GGDGFRTAGA GGRGGDGGKG ADPGGLFPIP GAGGKGGTGG      1260
     TGGTAHLGPL AIIGQSGQPG QFGSPGADGR GGAGGAGGGG GAGGSF                     1306
//

If you have problems or comments...

PBIL Back to PBIL home page