(data stored in ACNUC1104 zone)

EMBL: CP000717.PE589

CP000717.PE589       Location/Qualifiers
FT   CDS             679059..679538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10589"
FT                   /old_locus_tag="TBFG_00580"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0577"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10589"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04931"
FT                   /protein_id="ABR04931.1"
FT                   /translation="MAAVIVEPIFAKSVAAVVSISGVAITNDISLPRSGQPGVARRGKE
FT                   LCGYPGDLPCGANLRDPNSNDPLLTLSSKGQNPKLYANELSTVHPRFPSTRANGQTSTV
FT                   LAPRRYCRSSSRSRPGARTPLPSRDPAGEDKEWSAMWMSGHTPSSTSSWSCRRAV"
     MAAVIVEPIF AKSVAAVVSI SGVAITNDIS LPRSGQPGVA RRGKELCGYP GDLPCGANLR        60
     DPNSNDPLLT LSSKGQNPKL YANELSTVHP RFPSTRANGQ TSTVLAPRRY CRSSSRSRPG       120
     ARTPLPSRDP AGEDKEWSAM WMSGHTPSST SSWSCRRAV                              159
//

If you have problems or comments...

PBIL Back to PBIL home page