(data stored in ACNUC1104 zone)

EMBL: CP000717.PE59

CP000717.PE59        Location/Qualifiers
FT   CDS             64013..65071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10059"
FT                   /old_locus_tag="TBFG_00059"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0060"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10059"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04402"
FT                   /protein_id="ABR04402.1"
FT                   /translation="MITYGSGDLLRADTEALVNTVNCVGVMGKGIALQFKRRYPEMFTA
FT                   YEKACKRGEVTIGKMFVVDTGQLDGPKHIINFPTKKHWRAPSKLAYIDAGLIDLIRVIR
FT                   ELNIASVAVPPLGVGNGGLDWEDVEQRLVSAFQQLPDVDAVIYPPSGGSRAIEGVEGLR
FT                   MTWGRAVILEAMRRYLQQRRAMEPWEDPAGISHLEIQKLMYFANEADPDLALDFTPGRY
FT                   GPYSERVRHLLQGMEGAFTVGLGDGTARVLANQPISLTTKGTDAITDYLATDAAADRVS
FT                   AAVDTVLRVIEGFEGPYGVELLASTHWVATREGAKEPATAAAAVRKWTKRKGRIYSDDR
FT                   IGVALDRILMTA"
     MITYGSGDLL RADTEALVNT VNCVGVMGKG IALQFKRRYP EMFTAYEKAC KRGEVTIGKM        60
     FVVDTGQLDG PKHIINFPTK KHWRAPSKLA YIDAGLIDLI RVIRELNIAS VAVPPLGVGN       120
     GGLDWEDVEQ RLVSAFQQLP DVDAVIYPPS GGSRAIEGVE GLRMTWGRAV ILEAMRRYLQ       180
     QRRAMEPWED PAGISHLEIQ KLMYFANEAD PDLALDFTPG RYGPYSERVR HLLQGMEGAF       240
     TVGLGDGTAR VLANQPISLT TKGTDAITDY LATDAAADRV SAAVDTVLRV IEGFEGPYGV       300
     ELLASTHWVA TREGAKEPAT AAAAVRKWTK RKGRIYSDDR IGVALDRILM TA               352
//

If you have problems or comments...

PBIL Back to PBIL home page