(data stored in ACNUC1104 zone)

EMBL: CP000717.PE590

CP000717.PE590       Location/Qualifiers
FT   CDS             679466..680224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10590"
FT                   /old_locus_tag="TBFG_00581"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0579"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10590"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04933"
FT                   /protein_id="ABR04933.1"
FT                   /translation="MVGYVDVRAYAELNEFVELQARGLTVRRPFRSHQTVKDVLEAMGI
FT                   PHTEVDLILVNGDPADFSYRPVAGDRIAAYPMFEALDIGSTARLRPAPLRNPRFVVDVN
FT                   LGQLARLLRLLGFDTRWSSAADDPTLADISLGEQRILLTRDRGLLKRRAITHGLFVHSQ
FT                   HPEEQALEVLRRLDLNGRLAPLSRCLRCNGELAAVSKDEVIGQLEPLTRRYYESFSRCF
FT                   GCGRIYWPGSHHARLVRLVERLRDQLTTST"
     MVGYVDVRAY AELNEFVELQ ARGLTVRRPF RSHQTVKDVL EAMGIPHTEV DLILVNGDPA        60
     DFSYRPVAGD RIAAYPMFEA LDIGSTARLR PAPLRNPRFV VDVNLGQLAR LLRLLGFDTR       120
     WSSAADDPTL ADISLGEQRI LLTRDRGLLK RRAITHGLFV HSQHPEEQAL EVLRRLDLNG       180
     RLAPLSRCLR CNGELAAVSK DEVIGQLEPL TRRYYESFSR CFGCGRIYWP GSHHARLVRL       240
     VERLRDQLTT ST                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page