(data stored in ACNUC1104 zone)

EMBL: CP000717.PE595

CP000717.PE595       Location/Qualifiers
FT   CDS             682457..685090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10595"
FT                   /old_locus_tag="TBFG_00586"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0584"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10595"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04938"
FT                   /protein_id="ABR04938.1"
FT                   /translation="MRARRLRRALAALLAVAGLFVPFIVGVPTAYDGEPVFVAIPVEHV
FT                   NTLIGTGTGAAIVGEINNFPGASVPFGMVQYSPDTVDNYAGYDYDNPHSTGFSMTHASV
FT                   GCPAFGDISMLPTTTPLGSQPWSAWEEIAHDDTEVGVPGYYTVRFPGTGVIAELTATTR
FT                   TGVGRFRYPRNGWPALFHVRSGASLAGNYAATLQIEDNTTITGSATSGGFCGKKNLYTV
FT                   YFAMKFSQPFSSYGTWDGYAVYPGSHSMNSSYSGGYVGFPAGSVLEVRTALSYVSVDGA
FT                   RANLDAEGGASFDDIRAATSSEWNAALSRIAVAGRGPGDVDTFYTCLYRSLLHPNTFND
FT                   VDGRYIGFDGVIHSVASGHTHYANFSDWDTYRSLAPLQGLLFPQRASDMIQSLVTDAEQ
FT                   SGAYPRWALANSATGMMSGDSVVPLIVNLYAFGARDFDLKSALHYMVNAATQGGVGLDG
FT                   FLERPGIAAYLRLGYGPQTAEFRANGRIAGASVTLEWSVDDFAISRFADSLGDTATAAV
FT                   FQNRSQYWQNLFNPTTGYISPRSAAGFFPDGPGFVAYPSGFGQDGYDEGNAEQYLWWVP
FT                   HNVAGLVTALGGRTAVVKRLDRFTKKLNVGPNEPYLWAGNEPGFGVPWLYNYIGQPWKT
FT                   QRTVDRVRGLFGPTPGGAPGNDDLGALSSWYVWAALGLYPSTPGTTILTVNTPLFDRAV
FT                   IALPTGKSIQITAPGASGRNRLKYIDGLTIDRQPSNQTFLPESIVRTGGDLTFSLAGTP
FT                   NKVWGTAASAAPPSFGAGSSAVTVNIARPIIGIVPGATGTVTVDAQRMIDGVDDYTVTP
FT                   TSYVVGIAAEPLSGQFDDDGAVSASVAITVARSVPSGYYPIYVTTSAGDSARTLIVLVV
FT                   VAEAVE"
     MRARRLRRAL AALLAVAGLF VPFIVGVPTA YDGEPVFVAI PVEHVNTLIG TGTGAAIVGE        60
     INNFPGASVP FGMVQYSPDT VDNYAGYDYD NPHSTGFSMT HASVGCPAFG DISMLPTTTP       120
     LGSQPWSAWE EIAHDDTEVG VPGYYTVRFP GTGVIAELTA TTRTGVGRFR YPRNGWPALF       180
     HVRSGASLAG NYAATLQIED NTTITGSATS GGFCGKKNLY TVYFAMKFSQ PFSSYGTWDG       240
     YAVYPGSHSM NSSYSGGYVG FPAGSVLEVR TALSYVSVDG ARANLDAEGG ASFDDIRAAT       300
     SSEWNAALSR IAVAGRGPGD VDTFYTCLYR SLLHPNTFND VDGRYIGFDG VIHSVASGHT       360
     HYANFSDWDT YRSLAPLQGL LFPQRASDMI QSLVTDAEQS GAYPRWALAN SATGMMSGDS       420
     VVPLIVNLYA FGARDFDLKS ALHYMVNAAT QGGVGLDGFL ERPGIAAYLR LGYGPQTAEF       480
     RANGRIAGAS VTLEWSVDDF AISRFADSLG DTATAAVFQN RSQYWQNLFN PTTGYISPRS       540
     AAGFFPDGPG FVAYPSGFGQ DGYDEGNAEQ YLWWVPHNVA GLVTALGGRT AVVKRLDRFT       600
     KKLNVGPNEP YLWAGNEPGF GVPWLYNYIG QPWKTQRTVD RVRGLFGPTP GGAPGNDDLG       660
     ALSSWYVWAA LGLYPSTPGT TILTVNTPLF DRAVIALPTG KSIQITAPGA SGRNRLKYID       720
     GLTIDRQPSN QTFLPESIVR TGGDLTFSLA GTPNKVWGTA ASAAPPSFGA GSSAVTVNIA       780
     RPIIGIVPGA TGTVTVDAQR MIDGVDDYTV TPTSYVVGIA AEPLSGQFDD DGAVSASVAI       840
     TVARSVPSGY YPIYVTTSAG DSARTLIVLV VVAEAVE                                877
//

If you have problems or comments...

PBIL Back to PBIL home page