(data stored in ACNUC1104 zone)

EMBL: CP000717.PE597

CP000717.PE597       Location/Qualifiers
FT   CDS             687638..688360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10597"
FT                   /old_locus_tag="TBFG_00588"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   gntR-family"
FT                   /note="Mapped to H37Rv Rv0586"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10597"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04940"
FT                   /protein_id="ABR04940.1"
FT                   /translation="MALQPVTRRSVPEEVFEQIATDVLTGEMPPGEALPSERRLAELLG
FT                   VSRPAVREALKRLSAAGLVEVRQGDVTTVRDFRRHAGLDLLPRLLFRNGELDISVVRSI
FT                   LEARLRNFPKVAELAAERNEPELAELLQDSLRALDTEEDPIVWQRHTLDFWDHVVDSAG
FT                   SIVDRLMYNAFRAAYEPTLAALTTTMTAAAKRPSDYRKLADAICSGDPTGAKKAAQDLL
FT                   ELANTSLMAVLVSQASRQ"
     MALQPVTRRS VPEEVFEQIA TDVLTGEMPP GEALPSERRL AELLGVSRPA VREALKRLSA        60
     AGLVEVRQGD VTTVRDFRRH AGLDLLPRLL FRNGELDISV VRSILEARLR NFPKVAELAA       120
     ERNEPELAEL LQDSLRALDT EEDPIVWQRH TLDFWDHVVD SAGSIVDRLM YNAFRAAYEP       180
     TLAALTTTMT AAAKRPSDYR KLADAICSGD PTGAKKAAQD LLELANTSLM AVLVSQASRQ       240
//

If you have problems or comments...

PBIL Back to PBIL home page