(data stored in ACNUC1104 zone)

EMBL: CP000717.PE598

CP000717.PE598       Location/Qualifiers
FT   CDS             688357..689154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10598"
FT                   /old_locus_tag="TBFG_00589"
FT                   /product="hypothetical integral membrane protein yrbE2A"
FT                   /note="Mapped to H37Rv Rv0587"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10598"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04941"
FT                   /protein_id="ABR04941.1"
FT                   /translation="MTTHAVIITYLRDQTQPAVDAIGGFYRTCVLTGKALVRRPFHWRE
FT                   AIEQGWFITSVSLLPTLAVSIPLTVLIIFTLNILLAEFGAADISGAGAALGAVTQLGPL
FT                   TTVLVIAGAGATAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVVAATIVAALLNGA
FT                   VITIGLVGGFVFSVFIQHVSAGAYVGTLTLVTGLPEVIISVVKSATFGLIAGLVGCYRG
FT                   LTTKGGPKGVGTAVNETLVLCVIALFATNVVLTTIGVRFGTGH"
     MTTHAVIITY LRDQTQPAVD AIGGFYRTCV LTGKALVRRP FHWREAIEQG WFITSVSLLP        60
     TLAVSIPLTV LIIFTLNILL AEFGAADISG AGAALGAVTQ LGPLTTVLVI AGAGATAICA       120
     DLGARTIREE IDAMEVLGID PIHRLVVPRV VAATIVAALL NGAVITIGLV GGFVFSVFIQ       180
     HVSAGAYVGT LTLVTGLPEV IISVVKSATF GLIAGLVGCY RGLTTKGGPK GVGTAVNETL       240
     VLCVIALFAT NVVLTTIGVR FGTGH                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page