(data stored in ACNUC1104 zone)

EMBL: CP000717.PE60

CP000717.PE60        Location/Qualifiers
FT   CDS             complement(65116..65496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10060"
FT                   /old_locus_tag="TBFG_00060"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0060"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10060"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04403"
FT                   /protein_id="ABR04403.1"
FT                   /translation="MESAESIQRLTEFEMKLKFARLSTAILGCAAALVFPASVASADPP
FT                   DPHQPDMTKGYCPGGRWGFGDLAVCDGEKYPDGSFWHQWMQTWFTGPQFYFDCVSGGEP
FT                   LPGPPPPGGCGGAIPSEQPNAP"
     MESAESIQRL TEFEMKLKFA RLSTAILGCA AALVFPASVA SADPPDPHQP DMTKGYCPGG        60
     RWGFGDLAVC DGEKYPDGSF WHQWMQTWFT GPQFYFDCVS GGEPLPGPPP PGGCGGAIPS       120
     EQPNAP                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page