(data stored in ACNUC1104 zone)

EMBL: CP000717.PE600

CP000717.PE600       Location/Qualifiers
FT   CDS             690049..691263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10600"
FT                   /old_locus_tag="TBFG_00591"
FT                   /product="MCE-family protein mce2A"
FT                   /note="Mapped to H37Rv Rv0589"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10600"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04943"
FT                   /protein_id="ABR04943.1"
FT                   /translation="MPTLVTRKNRRAWLYVEGVVLLLVGALVLVLVYKQFRGEFTPKTE
FT                   LTMVASRAGLVMEAGSKVTYNGVEIGRVGSISEIERDGRPAAKLVLDVNPRYISLIPVN
FT                   VVADIEAATLFGNKYVALSAPKIPQQQRISSHDVIDVGSVTTEFNTLFETITSIAEKVD
FT                   PIELNATLSAVAQALDGLGGKFGESIVNGNQILAQLNPRLPQLGYDVRRLADLGEVYVD
FT                   ASPDLWSFLQNALTTARTLTSQQRDLDAALLAATGAGNTGEDVFARGGPYLARAAADLV
FT                   PTATLLDTYSPELFCMIRNFHDAAPKVADAVGGNGYSLAAAGTILGAPNPYVYPDNLPR
FT                   VNAHGGPGGRPGCWQTITRELWPAPYLVMDTGASLAPYNHVELGQPMFTEYVWGRQYGE
FT                   NTINP"
     MPTLVTRKNR RAWLYVEGVV LLLVGALVLV LVYKQFRGEF TPKTELTMVA SRAGLVMEAG        60
     SKVTYNGVEI GRVGSISEIE RDGRPAAKLV LDVNPRYISL IPVNVVADIE AATLFGNKYV       120
     ALSAPKIPQQ QRISSHDVID VGSVTTEFNT LFETITSIAE KVDPIELNAT LSAVAQALDG       180
     LGGKFGESIV NGNQILAQLN PRLPQLGYDV RRLADLGEVY VDASPDLWSF LQNALTTART       240
     LTSQQRDLDA ALLAATGAGN TGEDVFARGG PYLARAAADL VPTATLLDTY SPELFCMIRN       300
     FHDAAPKVAD AVGGNGYSLA AAGTILGAPN PYVYPDNLPR VNAHGGPGGR PGCWQTITRE       360
     LWPAPYLVMD TGASLAPYNH VELGQPMFTE YVWGRQYGEN TINP                        404
//

If you have problems or comments...

PBIL Back to PBIL home page