(data stored in ACNUC1104 zone)

EMBL: CP000717.PE602

CP000717.PE602       Location/Qualifiers
FT   CDS             692036..692290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10602"
FT                   /old_locus_tag="TBFG_00593"
FT                   /product="MCE-family related protein"
FT                   /note="Mapped to H37Rv Rv0590A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10602"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04945"
FT                   /protein_id="ABR04945.1"
FT                   /translation="MLHSSFGHLEGIQQPLIDELAELDHVLGKLPDAYRIIGRAGGIYG
FT                   DFFNFYLCDISLKVNGLQPGGPVRTVKLFGQPTGRCTPQ"
     MLHSSFGHLE GIQQPLIDEL AELDHVLGKL PDAYRIIGRA GGIYGDFFNF YLCDISLKVN        60
     GLQPGGPVRT VKLFGQPTGR CTPQ                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page